PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D12G2613
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 434aa    MW: 49355.3 Da    PI: 6.2013
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D12G2613genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.43.4e-18196242148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT eEd  l+++v+q+G + W+ Ia++++ gR +kqc++rw+++l
      Gh_D12G2613 196 KGQWTMEEDRMLIQLVEQYGVRKWSHIAQMLP-GRIGKQCRERWHNHL 242
                      799*****************************.*************97 PP

2Myb_DNA-binding56.18.3e-18248290145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      ++ W++eEd+ l++a+++ G++ W+ Ia++++ gRt++++k++w+
      Gh_D12G2613 248 KDTWSEEEDKVLIQAHREIGNK-WAEIAKRLP-GRTENSIKNHWN 290
                      679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129428.007191246IPR017930Myb domain
SMARTSM007175.0E-17195244IPR001005SANT/Myb domain
SuperFamilySSF466895.39E-32195289IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.9E-26197247IPR009057Homeodomain-like
PfamPF139211.7E-19199257No hitNo description
CDDcd001679.74E-16199242No hitNo description
SMARTSM007179.1E-17247295IPR001005SANT/Myb domain
PROSITE profilePS5129421.233247297IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.2E-22248295IPR009057Homeodomain-like
CDDcd001674.12E-13250293No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 434 aa     Download sequence    Send to blast
MEFDPNLREN MSPQHQHHPM MLSENNILKP LQTTTPLSSS SSKDYYLQDF HHLDDDDDDD  60
QIQVNVSSSS WNPVFGVNAA CYDPFDAFPY GCSTNRVDFY ECKPFAADHN TGNLRHGHVM  120
DNFQSSVGLL NLRNTISNDV IMMGSDVGYL PSFEFPNLGD EVPCVTAENG YRLLVDSTSS  180
RIRTNWKGRK KTNGVKGQWT MEEDRMLIQL VEQYGVRKWS HIAQMLPGRI GKQCRERWHN  240
HLRPDIKKDT WSEEEDKVLI QAHREIGNKW AEIAKRLPGR TENSIKNHWN ATKRRQFSKR  300
KCRSKYPRGS ILQEYIKSLN LDSTAAAAAR SHEKASDGAA VKAADNKSSS IKQPQGLDIG  360
PSTDRLVPEY ECDEVHEFSF DEKLLQESCS IELLLDQIPS TAAMADEKSF QMGDMGAVKK  420
EMDLVEMISA HPNI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C2e-461952963104C-Myb DNA-Binding Domain
1mse_C2e-461952963104C-Myb DNA-Binding Domain
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ6501060.0HQ650106.1 Gossypium hirsutum clone BAC 067L14, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012440417.10.0PREDICTED: transcription factor MYB98-like
SwissprotQ9S7L21e-98MYB98_ARATH; Transcription factor MYB98
TrEMBLA0A0D2RPR60.0A0A0D2RPR6_G
STRINGGLYMA05G02300.21e-127(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM58692847
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.14e-98myb domain protein 98